Lineage for d1v87a_ (1v87 A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524540Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 524541Superfamily g.44.1: RING/U-box [57850] (2 families) (S)
  5. 524542Family g.44.1.1: RING finger domain, C3HC4 [57851] (12 proteins)
  6. 524558Protein Deltex protein 2 RING-H2 domain [111457] (1 species)
  7. 524559Species Mouse (Mus musculus) [TaxId:10090] [111458] (1 PDB entry)
  8. 524560Domain d1v87a_: 1v87 A: [108422]
    Structural genomics target
    C-terminal RING domain; one zinc ion-bound structure adopts a different fold; misfolded conformation (?)

Details for d1v87a_

PDB Entry: 1v87 (more details)

PDB Description: solution structure of the ring-h2 finger domain of mouse deltex protein 2

SCOP Domain Sequences for d1v87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus)}
gssgssgepeqvirkyteelkvapeedciicmeklavasgysdmtdskalgpmvvgrltk
cshafhllcllamycngnkdgslqcpscktiygektgtqpwgkmevfrsgpssg

SCOP Domain Coordinates for d1v87a_:

Click to download the PDB-style file with coordinates for d1v87a_.
(The format of our PDB-style files is described here.)

Timeline for d1v87a_: