SCOPe 2.08: Domain d1v87a1: 1v87 A:8-108

Lineage for d1v87a1 (1v87 A:8-108)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)

6. Protein Deltex protein 2 RING-H2 domain [111457] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111458] (1 PDB entry)
   Uniprot Q8R3P2 389-489

8. Domain d1v87a1: 1v87 A:8-108 [108422]
   Other proteins in same PDB: d1v87a2, d1v87a3
   Structural genomics target
   C-terminal RING domain; one zinc ion-bound structure adopts a different fold; misfolded conformation (?)
   complexed with zn
   has additional insertions and/or extensions that are not grouped together

Details for d1v87a1

PDB Entry: 1v87

PDB Description: solution structure of the ring-h2 finger domain of mouse deltex protein 2

PDB Compounds: (A:) Deltex protein 2

SCOPe Domain Sequences for d1v87a1:

Sequence; same for both SEQRES and ATOM records:

>d1v87a1 g.44.1.1 (A:8-108) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}
epeqvirkyteelkvapeedciicmeklavasgysdmtdskalgpmvvgrltkcshafhl
lcllamycngnkdgslqcpscktiygektgtqpwgkmevfr

Timeline for d1v87a1:

• d1v87a1 first appeared in SCOP 1.69, called d1v87a_
  
• d1v87a1 appears in SCOPe 2.07