SCOPe 2.01: Domain d1v4ud_: 1v4u D:

Lineage for d1v4ud_ (1v4u D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109624] (3 PDB entries)
   Uniprot Q8AYM1

8. Domain d1v4ud_: 1v4u D: [108358]
   Other proteins in same PDB: d1v4ua_, d1v4uc_
   complexed with cmo, hem

Details for d1v4ud_

PDB Entry: 1v4u, 2 Å

PDB Description: Crystal structure of bluefin tuna carbonmonoxy-hemoglobin

PDB Compounds: (D:) hemoglobin beta chain

SCOPe Domain Sequences for d1v4ud_:

Sequence; same for both SEQRES and ATOM records:

>d1v4ud_ a.1.1.2 (D:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki
aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd
aftvetqcafqkflavvvfalg

Timeline for d1v4ud_:

• d1v4ud_ first appeared in SCOP 1.69
  
• d1v4ud_ appears in SCOP 1.75
  
• d1v4ud_ appears in SCOPe 2.02
  
• d1v4ud_ appears in the current release, SCOPe 2.08