Lineage for d1v4ud_ (1v4u D:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436496Protein Hemoglobin, beta-chain [46500] (20 species)
  7. 436507Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [109624] (3 PDB entries)
  8. 436513Domain d1v4ud_: 1v4u D: [108358]
    Other proteins in same PDB: d1v4ua_, d1v4uc_

Details for d1v4ud_

PDB Entry: 1v4u (more details), 2 Å

PDB Description: Crystal structure of bluefin tuna carbonmonoxy-hemoglobin

SCOP Domain Sequences for d1v4ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4ud_ a.1.1.2 (D:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus)}
vewtqqersiiagifanlnyedigpkalarclivypwtqryfgaygdlstpdaikgnaki
aahgvkvlhgldravknmdnineayselsvlhsdklhvdpdnfrilgdcltvviaanlgd
aftvetqcafqkflavvvfalg

SCOP Domain Coordinates for d1v4ud_:

Click to download the PDB-style file with coordinates for d1v4ud_.
(The format of our PDB-style files is described here.)

Timeline for d1v4ud_: