SCOPe 2.08: Domain d1v3ja1: 1v3j A:497-582

Lineage for d1v3ja1 (1v3j A:497-582)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
   follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases

7. Species Bacillus sp., strain 1011 [TaxId:1409] [49219] (8 PDB entries)
   Uniprot P05618

8. Domain d1v3ja1: 1v3j A:497-582 [108305]
   Other proteins in same PDB: d1v3ja2, d1v3ja3, d1v3ja4, d1v3jb2, d1v3jb3, d1v3jb4
   complexed with ca; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d1v3ja1

PDB Entry: 1v3j, 2 Å

PDB Description: crystal structure of f283l mutant cyclodextrin glycosyltransferase

PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1v3ja1:

Sequence; same for both SEQRES and ATOM records:

>d1v3ja1 b.1.18.2 (A:497-582) Cyclomaltodextrin glycanotransferase, domain D {Bacillus sp., strain 1011 [TaxId: 1409]}
ttpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgadivawedtqiqvkipav
pggiydirvanaagaasniydnfevl

Timeline for d1v3ja1:

• d1v3ja1 first appeared in SCOP 1.69
  
• d1v3ja1 appears in SCOPe 2.07