Lineage for d1v3jb3 (1v3j B:407-496)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries)
    Uniprot P05618
  8. Domain d1v3jb3: 1v3j B:407-496 [108311]
    Other proteins in same PDB: d1v3ja1, d1v3ja2, d1v3ja4, d1v3jb1, d1v3jb2, d1v3jb4
    complexed with ca; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1v3jb3

PDB Entry: 1v3j (more details), 2 Å

PDB Description: crystal structure of f283l mutant cyclodextrin glycosyltransferase
PDB Compounds: (B:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1v3jb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3jb3 b.71.1.1 (B:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011 [TaxId: 1409]}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

SCOPe Domain Coordinates for d1v3jb3 are not available.

Timeline for d1v3jb3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v3jb1, d1v3jb2, d1v3jb4
View in 3D
Domains from other chains:
(mouse over for more information)
d1v3ja1, d1v3ja2, d1v3ja3, d1v3ja4