| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) ![]() common motif contains conserved histidine residue and metal-binding site |
| Family d.4.1.1: HNH-motif [54061] (3 proteins) |
| Protein DNase domain of colicin E9 [54064] (1 species) |
| Species Escherichia coli [TaxId:562] [54065] (15 PDB entries) Uniprot P09883 456-581 |
| Domain d1v13b_: 1v13 B: [108231] protein/DNA complex; complexed with zn; mutant |
PDB Entry: 1v13 (more details), 2 Å
SCOPe Domain Sequences for d1v13b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v13b_ d.4.1.1 (B:) DNase domain of colicin E9 {Escherichia coli [TaxId: 562]}
pgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweevskdpel
sknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnirvttpkrh
idihrg
Timeline for d1v13b_: