SCOPe 2.05: Domain d1v13b_: 1v13 B:

Lineage for d1v13b_ (1v13 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein DNase domain of colicin E9 [54064] (1 species)

7. Species Escherichia coli [TaxId:562] [54065] (15 PDB entries)
   Uniprot P09883 456-581

8. Domain d1v13b_: 1v13 B: [108231]
   protein/DNA complex; complexed with zn; mutant

Details for d1v13b_

PDB Entry: 1v13, 2 Å

PDB Description: crystal structure of the mutant his103ala of the colicin e9 dnase domain in complex with zn+2 (2.0 angstroms)

PDB Compounds: (B:) colicin e9

SCOPe Domain Sequences for d1v13b_:

Sequence; same for both SEQRES and ATOM records:

>d1v13b_ d.4.1.1 (B:) DNase domain of colicin E9 {Escherichia coli [TaxId: 562]}
pgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweevskdpel
sknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnirvttpkrh
idihrg

Timeline for d1v13b_:

• d1v13b_ first appeared in SCOP 1.69
  
• d1v13b_ appears in SCOPe 2.04
  
• d1v13b_ appears in SCOPe 2.06
  
• d1v13b_ appears in the current release, SCOPe 2.08