Lineage for d1v13b_ (1v13 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1399804Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 1399805Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 1399806Family d.4.1.1: HNH-motif [54061] (3 proteins)
  6. 1399825Protein DNase domain of colicin E9 [54064] (1 species)
  7. 1399826Species Escherichia coli [TaxId:562] [54065] (14 PDB entries)
    Uniprot P09883 456-581
  8. 1399844Domain d1v13b_: 1v13 B: [108231]
    protein/DNA complex; complexed with zn; mutant

Details for d1v13b_

PDB Entry: 1v13 (more details), 2 Å

PDB Description: crystal structure of the mutant his103ala of the colicin e9 dnase domain in complex with zn+2 (2.0 angstroms)
PDB Compounds: (B:) colicin e9

SCOPe Domain Sequences for d1v13b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v13b_ d.4.1.1 (B:) DNase domain of colicin E9 {Escherichia coli [TaxId: 562]}
pgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweevskdpel
sknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnirvttpkrh
idihrg

SCOPe Domain Coordinates for d1v13b_:

Click to download the PDB-style file with coordinates for d1v13b_.
(The format of our PDB-style files is described here.)

Timeline for d1v13b_: