| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Malate dehydrogenase [51849] (13 species) |
| Species Chloroflexus aurantiacus [TaxId:1108] [69415] (7 PDB entries) Uniprot P80040 |
| Domain d1uxhb1: 1uxh B:2-143 [108106] Other proteins in same PDB: d1uxha2, d1uxhb2 complexed with fum, nad; mutant |
PDB Entry: 1uxh (more details), 2.1 Å
SCOPe Domain Sequences for d1uxhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uxhb1 c.2.1.5 (B:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]}
rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg
tnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnnp
ldamtylaaevsgfpkervigq
Timeline for d1uxhb1: