PDB entry 1uxh

View 1uxh on RCSB PDB site
Description: Large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface
Class: oxidoreductase
Keywords: oxidoreductase, tricarboxylic acid cycle, malate dehydrogenase
Deposited on 2004-02-25, released 2004-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Chloroflexus aurantiacus [TaxId:1108]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80040 (Start-308)
      • engineered mutation (164)
    Domains in SCOPe 2.08: d1uxha1, d1uxha2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Chloroflexus aurantiacus [TaxId:1108]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80040 (Start-308)
      • engineered mutation (164)
    Domains in SCOPe 2.08: d1uxhb1, d1uxhb2
  • Heterogens: NAD, FUM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uxhA (A:)
    mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
    gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn
    pldamtylaaevsgfpkervigqagvldaaryrtfiameagvsvqdvqamlmgghgdemv
    plprfstisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveav
    lkdkkrvmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavr
    atldtlksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxhA (A:)
    rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg
    tnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnnp
    ldamtylaaevsgfpkervigqagvldaaryrtfiameagvsvqdvqamlmgghgdemvp
    lprfstisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveavl
    kdkkrvmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavra
    tldtlksl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uxhB (B:)
    mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
    gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn
    pldamtylaaevsgfpkervigqagvldaaryrtfiameagvsvqdvqamlmgghgdemv
    plprfstisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveav
    lkdkkrvmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavr
    atldtlksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uxhB (B:)
    rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg
    tnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnnp
    ldamtylaaevsgfpkervigqagvldaaryrtfiameagvsvqdvqamlmgghgdemvp
    lprfstisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveavl
    kdkkrvmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavra
    tldtlksl