Lineage for d1uxhb1 (1uxh B:2-143)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452663Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2453110Protein Malate dehydrogenase [51849] (13 species)
  7. 2453132Species Chloroflexus aurantiacus [TaxId:1108] [69415] (7 PDB entries)
    Uniprot P80040
  8. 2453144Domain d1uxhb1: 1uxh B:2-143 [108106]
    Other proteins in same PDB: d1uxha2, d1uxhb2
    complexed with fum, nad; mutant

Details for d1uxhb1

PDB Entry: 1uxh (more details), 2.1 Å

PDB Description: large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1uxhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxhb1 c.2.1.5 (B:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]}
rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg
tnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnnp
ldamtylaaevsgfpkervigq

SCOPe Domain Coordinates for d1uxhb1:

Click to download the PDB-style file with coordinates for d1uxhb1.
(The format of our PDB-style files is described here.)

Timeline for d1uxhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uxhb2