Lineage for d1urqa_ (1urq A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040219Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 3040220Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 3040227Protein M-tomosyn [111467] (1 species)
  7. 3040228Species Norway rat (Rattus norvegicus) [TaxId:10116] [111468] (1 PDB entry)
    Uniprot Q9Z152
  8. 3040229Domain d1urqa_: 1urq A: [107994]
    Other proteins in same PDB: d1urqb_, d1urqc_, d1urqd1, d1urqd2

Details for d1urqa_

PDB Entry: 1urq (more details), 2 Å

PDB Description: crystal structure of neuronal q-snares in complex with r-snare motif of tomosyn
PDB Compounds: (A:) m-tomosyn isoform

SCOPe Domain Sequences for d1urqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urqa_ h.1.15.1 (A:) M-tomosyn {Norway rat (Rattus norvegicus) [TaxId: 10116]}
giegvkgaasgvvgelararlaldergqklsdleertaammssadsfskhahemmlky

SCOPe Domain Coordinates for d1urqa_:

Click to download the PDB-style file with coordinates for d1urqa_.
(The format of our PDB-style files is described here.)

Timeline for d1urqa_: