![]() | Class h: Coiled coil proteins [57942] (6 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (28 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.15: SNARE fusion complex [58038] (1 family) ![]() tetrameric parallel coiled coil |
![]() | Family h.1.15.1: SNARE fusion complex [58039] (11 proteins) |
![]() | Protein M-tomosyn [111467] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [111468] (1 PDB entry) |
![]() | Domain d1urqa_: 1urq A: [107994] Other proteins in same PDB: d1urqb_, d1urqc_, d1urqd_ |
PDB Entry: 1urq (more details), 2 Å
SCOP Domain Sequences for d1urqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urqa_ h.1.15.1 (A:) M-tomosyn {Rat (Rattus norvegicus)} giegvkgaasgvvgelararlaldergqklsdleertaammssadsfskhahemmlky
Timeline for d1urqa_: