PDB entry 1urq

View 1urq on RCSB PDB site
Description: crystal structure of neuronal q-snares in complex with r-snare motif of tomosyn
Class: transport protein
Keywords: transport protein, tomosyn-snare complex, exocytosis, four helical bundle, coiled coil
Deposited on 2003-10-31, released 2004-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1661
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: m-tomosyn isoform
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1urqa_
  • Chain 'B':
    Compound: syntaxin 1a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1urqb_
  • Chain 'C':
    Compound: synaptosomal-associated protein 25
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1urqc_
  • Chain 'D':
    Compound: synaptosomal-associated protein 25
    Species: Rattus norvegicus [TaxId:10116]
    Domains in SCOPe 2.07: d1urqd1, d1urqd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1urqA (A:)
    gshggiegvkgaasgvvgelararlaldergqklsdleertaammssadsfskhahemml
    kyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urqA (A:)
    giegvkgaasgvvgelararlaldergqklsdleertaammssadsfskhahemmlky
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1urqB (B:)
    gshskqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyv
    eravsdtkkavkyqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urqB (B:)
    etrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsdtkkav
    kyqs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1urqC (C:)
    gshmrneleemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrveeg
    mnhinqdmkeaeknlkdlgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urqC (C:)
    rradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrveegmnhinqdmkeae
    knlkdlgk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1urqD (D:)
    gshmasrenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktridea
    nqratkmlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urqD (D:)
    masrenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktrideanqr
    at