Lineage for d1umla_ (1uml A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833367Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)
  6. 2833368Protein Adenosine deaminase (ADA) [51558] (4 species)
    Common fold covers the whole protein structure
  7. 2833369Species Cow (Bos taurus) [TaxId:9913] [82257] (13 PDB entries)
    Uniprot P56658 3-350 ! Uniprot P56658
  8. 2833379Domain d1umla_: 1uml A: [107957]
    complexed with fr4, zn

Details for d1umla_

PDB Entry: 1uml (more details), 2.5 Å

PDB Description: crystal structure of adenosine deaminase complexed with a potent inhibitor fr233624
PDB Compounds: (A:) adenosine deaminase

SCOPe Domain Sequences for d1umla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umla_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Cow (Bos taurus) [TaxId: 9913]}
tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla
kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr

SCOPe Domain Coordinates for d1umla_:

Click to download the PDB-style file with coordinates for d1umla_.
(The format of our PDB-style files is described here.)

Timeline for d1umla_: