SCOPe 2.08: Domain d1ufza1: 1ufz A:8-77

Lineage for d1ufza1 (1ufz A:8-77)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.9: HBS1-like domain [109732] (1 family)
   possibly related to UBA-like domains
   automatically mapped to Pfam PF08938

5. Family a.5.9.1: HBS1-like domain [109733] (1 protein)

6. Protein HBS1-like protein [109734] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109735] (1 PDB entry)
   Uniprot Q69ZS7 51-120

8. Domain d1ufza1: 1ufz A:8-77 [107821]
   Other proteins in same PDB: d1ufza2, d1ufza3
   Structural genomics target

Details for d1ufza1

PDB Entry: 1ufz

PDB Description: solution structure of hbs1-like domain in hypothetical protein bab28515

PDB Compounds: (A:) Hypothetical protein BAB28515

SCOPe Domain Sequences for d1ufza1:

Sequence; same for both SEQRES and ATOM records:

>d1ufza1 a.5.9.1 (A:8-77) HBS1-like protein {Mouse (Mus musculus) [TaxId: 10090]}
eygyedlressnsllnhqlseidqarlyscldhmrevlgdavpddilteailkhkfdvqk
alsvvleqdg

Timeline for d1ufza1:

• d1ufza1 first appeared in SCOP 1.69, called d1ufza_
  
• d1ufza1 appears in SCOPe 2.07