PDB entry 1ufz

View 1ufz on RCSB PDB site
Description: Solution structure of HBS1-like domain in hypothetical protein BAB28515
Class: translation
Keywords: NMR, HBS1-like domain, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSLATION
Deposited on 2003-06-11, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein BAB28515
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2810035F15
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q69ZS7 (7-76)
      • cloning artifact (0-6)
      • cloning artifact (77-82)
    Domains in SCOPe 2.08: d1ufza1, d1ufza2, d1ufza3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ufzA (A:)
    gssgssgeygyedlressnsllnhqlseidqarlyscldhmrevlgdavpddilteailk
    hkfdvqkalsvvleqdgsgpssg