Lineage for d1ufza_ (1ufz A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439425Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 439555Superfamily a.5.9: HBS1-like domain [109732] (1 family) (S)
    possibly related to UBA-like domains
  5. 439556Family a.5.9.1: HBS1-like domain [109733] (1 protein)
  6. 439557Protein HBS1-like protein [109734] (1 species)
  7. 439558Species Mouse (Mus musculus) [TaxId:10090] [109735] (1 PDB entry)
  8. 439559Domain d1ufza_: 1ufz A: [107821]
    Structural genomics target

Details for d1ufza_

PDB Entry: 1ufz (more details)

PDB Description: solution structure of hbs1-like domain in hypothetical protein bab28515

SCOP Domain Sequences for d1ufza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufza_ a.5.9.1 (A:) HBS1-like protein {Mouse (Mus musculus)}
gssgssgeygyedlressnsllnhqlseidqarlyscldhmrevlgdavpddilteailk
hkfdvqkalsvvleqdgsgpssg

SCOP Domain Coordinates for d1ufza_:

Click to download the PDB-style file with coordinates for d1ufza_.
(The format of our PDB-style files is described here.)

Timeline for d1ufza_: