Lineage for d1u9la_ (1u9l A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) (S)
    contains one classic and one pseudo HhH motifs
  5. Family a.60.4.2: NusA extra C-terminal domains [109873] (2 proteins)
  6. Protein Transcription elongation protein NusA [109874] (1 species)
  7. Species Escherichia coli [TaxId:562] [109875] (1 PDB entry)
    Uniprot P03003 352-419
  8. Domain d1u9la_: 1u9l A: [107751]
    complexed with au

Details for d1u9la_

PDB Entry: 1u9l (more details), 1.9 Å

PDB Description: Structural basis for a NusA- protein N interaction
PDB Compounds: (A:) Transcription elongation protein nusA

SCOPe Domain Sequences for d1u9la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u9la_ a.60.4.2 (A:) Transcription elongation protein NusA {Escherichia coli [TaxId: 562]}
ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
nalatiaq

SCOPe Domain Coordinates for d1u9la_ are not available.

Timeline for d1u9la_:

Domains from other chains:
(mouse over for more information)
d1u9lb_