Lineage for d1u9la_ (1u9l A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444234Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 444351Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 444367Family a.60.4.2: NusA extra C-terminal domains [109873] (1 protein)
  6. 444368Protein Transcription elongation protein NusA [109874] (1 species)
  7. 444369Species Escherichia coli [TaxId:562] [109875] (1 PDB entry)
  8. 444370Domain d1u9la_: 1u9l A: [107751]

Details for d1u9la_

PDB Entry: 1u9l (more details), 1.9 Å

PDB Description: Structural basis for a NusA- protein N interaction

SCOP Domain Sequences for d1u9la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u9la_ a.60.4.2 (A:) Transcription elongation protein NusA {Escherichia coli}
ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
nalatiaq

SCOP Domain Coordinates for d1u9la_:

Click to download the PDB-style file with coordinates for d1u9la_.
(The format of our PDB-style files is described here.)

Timeline for d1u9la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u9lb_