SCOPe 2.07: Domain d1u34a1: 1u34 A:39-133

Lineage for d1u34a1 (1u34 A:39-133)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.76: Hormone receptor domain [111417] (1 superfamily)
   disulfide-rich all-beta fold; contains beta sandwich of 5 strands

4. Superfamily g.76.1: Hormone receptor domain [111418] (1 family)

5. Family g.76.1.1: Hormone receptor domain [111419] (2 proteins)
   Pfam PF02793; HRM

6. Protein Corticotropin releasing factor receptor 2, CRFR-2beta [111420] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111421] (1 PDB entry)
   Uniprot Q60748 39-133

8. Domain d1u34a1: 1u34 A:39-133 [107634]
   Other proteins in same PDB: d1u34a2

Details for d1u34a1

PDB Entry: 1u34

PDB Description: 3d nmr structure of the first extracellular domain of crfr-2beta, a type b1 g-protein coupled receptor

PDB Compounds: (A:) Corticotropin releasing factor receptor 2

SCOPe Domain Sequences for d1u34a1:

Sequence; same for both SEQRES and ATOM records:

>d1u34a1 g.76.1.1 (A:39-133) Corticotropin releasing factor receptor 2, CRFR-2beta {Mouse (Mus musculus) [TaxId: 10090]}
tlleqychrttignfsgpytycnttldqigtcwpqsapgalverpcpeyfngikynttrn
ayreclengtwasrvnyshcepilddkqrkydlhy

Timeline for d1u34a1:

• d1u34a1 first appeared in SCOP 1.69, called d1u34a_
  
• d1u34a1 appears in SCOPe 2.06
  
• d1u34a1 appears in the current release, SCOPe 2.08