Lineage for d1u34a1 (1u34 A:39-133)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038650Fold g.76: Hormone receptor domain [111417] (1 superfamily)
    disulfide-rich all-beta fold; contains beta sandwich of 5 strands
  4. 3038651Superfamily g.76.1: Hormone receptor domain [111418] (1 family) (S)
  5. 3038652Family g.76.1.1: Hormone receptor domain [111419] (2 proteins)
    Pfam PF02793; HRM
  6. 3038653Protein Corticotropin releasing factor receptor 2, CRFR-2beta [111420] (1 species)
  7. 3038654Species Mouse (Mus musculus) [TaxId:10090] [111421] (1 PDB entry)
    Uniprot Q60748 39-133
  8. 3038655Domain d1u34a1: 1u34 A:39-133 [107634]
    Other proteins in same PDB: d1u34a2

Details for d1u34a1

PDB Entry: 1u34 (more details)

PDB Description: 3d nmr structure of the first extracellular domain of crfr-2beta, a type b1 g-protein coupled receptor
PDB Compounds: (A:) Corticotropin releasing factor receptor 2

SCOPe Domain Sequences for d1u34a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u34a1 g.76.1.1 (A:39-133) Corticotropin releasing factor receptor 2, CRFR-2beta {Mouse (Mus musculus) [TaxId: 10090]}
tlleqychrttignfsgpytycnttldqigtcwpqsapgalverpcpeyfngikynttrn
ayreclengtwasrvnyshcepilddkqrkydlhy

SCOPe Domain Coordinates for d1u34a1:

Click to download the PDB-style file with coordinates for d1u34a1.
(The format of our PDB-style files is described here.)

Timeline for d1u34a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u34a2