PDB entry 1u34

View 1u34 on RCSB PDB site
Description: 3D NMR structure of the first extracellular domain of CRFR-2beta, a type B1 G-protein coupled receptor
Class: signaling protein
Keywords: Beta sheets and Loops, SIGNALING PROTEIN
Deposited on 2004-07-20, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Corticotropin releasing factor receptor 2
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60748 (24-118)
    • cloning artifact (0-23)
  Domains in SCOPe 2.07: d1u34a1, d1u34a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u34A (A:)
  gsgmketaaakferqhmdspdlgttlleqychrttignfsgpytycnttldqigtcwpqs
  apgalverpcpeyfngikynttrnayreclengtwasrvnyshcepilddkqrkydlhy