| Class b: All beta proteins [48724] (180 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
| Family b.43.3.1: Elongation factors [50448] (11 proteins) |
| Protein Elongation factor 2 (eEF-2), domain II [82118] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries) Uniprot P32324 |
| Domain d1u2ra1: 1u2r A:344-481 [107617] Other proteins in same PDB: d1u2ra2, d1u2ra3, d1u2ra4, d1u2ra5 complexed with apr, gdp, mg, so1 |
PDB Entry: 1u2r (more details), 2.6 Å
SCOPe Domain Sequences for d1u2ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2ra1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm
Timeline for d1u2ra1:
View in 3DDomains from same chain: (mouse over for more information) d1u2ra2, d1u2ra3, d1u2ra4, d1u2ra5 |