SCOPe 2.08: Domain d1u2ra4: 1u2r A:482-560

Lineage for d1u2ra4 (1u2r A:482-560)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)

5. Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
   domain III structure is lacking some of the superfamily characters and is often disordered in crystals

6. Protein Elongation factor 2 (eEF-2), N-terminal domain [419042] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419527] (13 PDB entries)
   Uniprot P32324

8. Domain d1u2ra4: 1u2r A:482-560 [107620]
   Other proteins in same PDB: d1u2ra1, d1u2ra2, d1u2ra3, d1u2ra5
   complexed with apr, gdp, mg, so1

Details for d1u2ra4

PDB Entry: 1u2r, 2.6 Å

PDB Description: Crystal Structure of ADP-ribosylated Ribosomal Translocase from Saccharomyces cerevisiae

PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d1u2ra4:

Sequence; same for both SEQRES and ATOM records:

>d1u2ra4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2), N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic
lqdlehdhagvplkisppv

Timeline for d1u2ra4:

• d1u2ra4 first appeared in SCOP 1.69
  
• d1u2ra4 appears in SCOPe 2.07