Lineage for d1u2ra1 (1u2r A:344-481)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464636Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464647Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 464648Family b.43.3.1: Elongation factors [50448] (8 proteins)
  6. 464649Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species)
  7. 464650Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (3 PDB entries)
  8. 464652Domain d1u2ra1: 1u2r A:344-481 [107617]
    Other proteins in same PDB: d1u2ra2, d1u2ra3, d1u2ra4, d1u2ra5

Details for d1u2ra1

PDB Entry: 1u2r (more details), 2.6 Å

PDB Description: Crystal Structure of ADP-ribosylated Ribosomal Translocase from Saccharomyces cerevisiae

SCOP Domain Sequences for d1u2ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2ra1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae)}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOP Domain Coordinates for d1u2ra1:

Click to download the PDB-style file with coordinates for d1u2ra1.
(The format of our PDB-style files is described here.)

Timeline for d1u2ra1: