SCOPe 2.08: Domain d1u1ic1: 1u1i C:801-1027,C:1133-1192

Lineage for d1u1ic1 (1u1i C:801-1027,C:1133-1192)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Myo-inositol 1-phosphate synthase [75105] (4 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [110418] (3 PDB entries)
   Uniprot O28480

8. Domain d1u1ic1: 1u1i C:801-1027,C:1133-1192 [107586]
   Other proteins in same PDB: d1u1ia2, d1u1ib2, d1u1ic2, d1u1id2
   complexed with k, nad, po4
   has additional insertions and/or extensions that are not grouped together

Details for d1u1ic1

PDB Entry: 1u1i, 1.9 Å

PDB Description: myo-inositol phosphate synthase mips from a. fulgidus

PDB Compounds: (C:) myo-inositol-1-phosphate synthase

SCOPe Domain Sequences for d1u1ic1:

Sequence; same for both SEQRES and ATOM records:

>d1u1ic1 c.2.1.3 (C:801-1027,C:1133-1192) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus [TaxId: 2234]}
mkvwlvgaygivsttamvgaraiergiapkiglvselphfegiekyapfsfefggheirl
lsnayeaakehwelnrhfdreileavksdlegivarkgtalncgsgikelgdiktlegeg
lslaemvsrieediksfaddetvvinvasteplpnyseeyhgslegfermidedrkeyas
asmlyayaalklglpyanftpspgsaipalkelaekkgvphagndgkXaivaaplildia
rfllfakkkgvkgvvkemafffkspmdtnvintheqfvvlkewysnlk

Timeline for d1u1ic1:

• d1u1ic1 first appeared in SCOP 1.69
  
• d1u1ic1 appears in SCOPe 2.07