Lineage for d1u1ic2 (1u1i C:1028-1132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2962012Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2962094Protein Myo-inositol 1-phosphate synthase [75484] (4 species)
  7. 2962095Species Archaeoglobus fulgidus [TaxId:2234] [111049] (3 PDB entries)
    Uniprot O28480
  8. 2962099Domain d1u1ic2: 1u1i C:1028-1132 [107587]
    Other proteins in same PDB: d1u1ia1, d1u1ib1, d1u1ic1, d1u1id1
    complexed with k, nad, po4

Details for d1u1ic2

PDB Entry: 1u1i (more details), 1.9 Å

PDB Description: myo-inositol phosphate synthase mips from a. fulgidus
PDB Compounds: (C:) myo-inositol-1-phosphate synthase

SCOPe Domain Sequences for d1u1ic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1ic2 d.81.1.3 (C:1028-1132) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus [TaxId: 2234]}
tgetlvkttlapmfayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlg
yspysiteiqyfpslvdnktafdfvhfkgflgklmkfyfiwdaid

SCOPe Domain Coordinates for d1u1ic2:

Click to download the PDB-style file with coordinates for d1u1ic2.
(The format of our PDB-style files is described here.)

Timeline for d1u1ic2: