Lineage for d1u14a_ (1u14 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1603870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1604067Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 1604111Family c.51.4.3: YjjX-like [110621] (2 proteins)
    Pfam PF01931
  6. 1604115Protein Hypothetical protein YjjX [110622] (2 species)
  7. 1604125Species Salmonella typhimurium [TaxId:90371] [110623] (1 PDB entry)
    Uniprot P39432
  8. 1604126Domain d1u14a_: 1u14 A: [107579]
    Structural genomics target
    complexed with po4

Details for d1u14a_

PDB Entry: 1u14 (more details), 1.68 Å

PDB Description: The crystal structure of hypothetical UPF0244 protein yjjX at resolution 1.68 Angstrom
PDB Compounds: (A:) Hypothetical UPF0244 protein yjjX

SCOPe Domain Sequences for d1u14a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u14a_ c.51.4.3 (A:) Hypothetical protein YjjX {Salmonella typhimurium [TaxId: 90371]}
amhqvisattnpakiqailqafeeifgegschitpvavesgvpeqpfgseetragarnrv
dnarrlhpqadfwvaieagidddatfswvvidngvqrgearsatlplpavildrvrqgea
lgpvmsqytgideigrkegaigvftagkltrssvyyqavilalspfhna

SCOPe Domain Coordinates for d1u14a_:

Click to download the PDB-style file with coordinates for d1u14a_.
(The format of our PDB-style files is described here.)

Timeline for d1u14a_: