SCOPe 2.05: Domain d1u14a_: 1u14 A:

Lineage for d1u14a_ (1u14 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.3: YjjX-like [110621] (2 proteins)
   Pfam PF01931

6. Protein Hypothetical protein YjjX [110622] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [110623] (1 PDB entry)
   Uniprot P39432

8. Domain d1u14a_: 1u14 A: [107579]
   Structural genomics target
   complexed with po4

Details for d1u14a_

PDB Entry: 1u14, 1.68 Å

PDB Description: The crystal structure of hypothetical UPF0244 protein yjjX at resolution 1.68 Angstrom

PDB Compounds: (A:) Hypothetical UPF0244 protein yjjX

SCOPe Domain Sequences for d1u14a_:

Sequence; same for both SEQRES and ATOM records:

>d1u14a_ c.51.4.3 (A:) Hypothetical protein YjjX {Salmonella typhimurium [TaxId: 90371]}
amhqvisattnpakiqailqafeeifgegschitpvavesgvpeqpfgseetragarnrv
dnarrlhpqadfwvaieagidddatfswvvidngvqrgearsatlplpavildrvrqgea
lgpvmsqytgideigrkegaigvftagkltrssvyyqavilalspfhna

Timeline for d1u14a_:

• d1u14a_ first appeared in SCOP 1.69
  
• d1u14a_ appears in SCOPe 2.04
  
• d1u14a_ is called d1u14a1 in SCOPe 2.06
  
• d1u14a_ appears in the current release, SCOPe 2.08, called d1u14a1