![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.4: Maf/Ham1 [52972] (3 families) ![]() elaborated with additional structures inserted in the common fold |
![]() | Family c.51.4.3: YjjX-like (Pfam 01931) [110621] (1 protein) |
![]() | Protein Hypothetical protein YjjX [110622] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [110623] (1 PDB entry) |
![]() | Domain d1u14a_: 1u14 A: [107579] |
PDB Entry: 1u14 (more details), 1.68 Å
SCOP Domain Sequences for d1u14a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u14a_ c.51.4.3 (A:) Hypothetical protein YjjX {Salmonella typhimurium} amhqvisattnpakiqailqafeeifgegschitpvavesgvpeqpfgseetragarnrv dnarrlhpqadfwvaieagidddatfswvvidngvqrgearsatlplpavildrvrqgea lgpvmsqytgideigrkegaigvftagkltrssvyyqavilalspfhna
Timeline for d1u14a_: