Lineage for d1u14a_ (1u14 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 487574Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 487707Superfamily c.51.4: Maf/Ham1 [52972] (3 families) (S)
    elaborated with additional structures inserted in the common fold
  5. 487727Family c.51.4.3: YjjX-like (Pfam 01931) [110621] (1 protein)
  6. 487728Protein Hypothetical protein YjjX [110622] (1 species)
  7. 487729Species Salmonella typhimurium [TaxId:90371] [110623] (1 PDB entry)
  8. 487730Domain d1u14a_: 1u14 A: [107579]

Details for d1u14a_

PDB Entry: 1u14 (more details), 1.68 Å

PDB Description: The crystal structure of hypothetical UPF0244 protein yjjX at resolution 1.68 Angstrom

SCOP Domain Sequences for d1u14a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u14a_ c.51.4.3 (A:) Hypothetical protein YjjX {Salmonella typhimurium}
amhqvisattnpakiqailqafeeifgegschitpvavesgvpeqpfgseetragarnrv
dnarrlhpqadfwvaieagidddatfswvvidngvqrgearsatlplpavildrvrqgea
lgpvmsqytgideigrkegaigvftagkltrssvyyqavilalspfhna

SCOP Domain Coordinates for d1u14a_:

Click to download the PDB-style file with coordinates for d1u14a_.
(The format of our PDB-style files is described here.)

Timeline for d1u14a_: