![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
![]() | Protein Viral RNA polymerase [56695] (17 species) |
![]() | Species Foot-and-mouth disease virus [TaxId:12110] [111302] (7 PDB entries) Uniprot Q9QCE4 1858-2327 |
![]() | Domain d1u09a1: 1u09 A:1-470 [107545] Other proteins in same PDB: d1u09a2 protein/DNA complex; protein/RNA complex missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1u09 (more details), 1.91 Å
SCOPe Domain Sequences for d1u09a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u09a1 e.8.1.4 (A:1-470) Viral RNA polymerase {Foot-and-mouth disease virus [TaxId: 12110]} glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda
Timeline for d1u09a1: