PDB entry 1u09

View 1u09 on RCSB PDB site
Description: Footand Mouth Disease Virus RNA-dependent RNA polymerase
Class: transferase
Keywords: PROTEIN-DNA COMPLEX, RNA-DEPENDENT RNA POLYMERASE, FOOT AND MOUTH DISEASE VIRUS, transferase
Deposited on 2004-07-13, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.21
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyprotein
    Species: Foot-and-mouth disease virus [TaxId:244367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u09a1, d1u09a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u09A (A:)
    glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
    kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
    walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
    vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
    ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
    satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
    gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
    qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaalehh