Lineage for d1tyhe_ (1tyh E:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098898Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1098899Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1099026Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 1099063Protein Transcriptional activator TenA [110030] (1 species)
  7. 1099064Species Bacillus subtilis [TaxId:1423] [110031] (4 PDB entries)
    Uniprot P25052
  8. 1099078Domain d1tyhe_: 1tyh E: [107461]

Details for d1tyhe_

PDB Entry: 1tyh (more details), 2.54 Å

PDB Description: crystal structure of transcriptional activator tena from bacillus subtilis
PDB Compounds: (E:) Transcriptional activator tenA

SCOPe Domain Sequences for d1tyhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyhe_ a.132.1.3 (E:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
lkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaa
yakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsv
lsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfd
elaensteevrakmkenfvissyyeyqfwgmayrkegwsds

SCOPe Domain Coordinates for d1tyhe_:

Click to download the PDB-style file with coordinates for d1tyhe_.
(The format of our PDB-style files is described here.)

Timeline for d1tyhe_: