Lineage for d1tyhe_ (1tyh E:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448927Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 448928Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 448995Family a.132.1.3: TENA/THI-4 [101458] (4 proteins)
    Pfam 03070; HO-related family lacking the heme-binding site
  6. 449012Protein Transcriptional activator TenA [110030] (1 species)
  7. 449013Species Bacillus subtilis [TaxId:1423] [110031] (2 PDB entries)
  8. 449019Domain d1tyhe_: 1tyh E: [107461]

Details for d1tyhe_

PDB Entry: 1tyh (more details), 2.54 Å

PDB Description: crystal structure of transcriptional activator tena from bacillus subtilis

SCOP Domain Sequences for d1tyhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyhe_ a.132.1.3 (E:) Transcriptional activator TenA {Bacillus subtilis}
lkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaa
yakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsv
lsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfd
elaensteevrakmkenfvissyyeyqfwgmayrkegwsds

SCOP Domain Coordinates for d1tyhe_:

Click to download the PDB-style file with coordinates for d1tyhe_.
(The format of our PDB-style files is described here.)

Timeline for d1tyhe_: