SCOPe 2.01: Domain d1tyhe_: 1tyh E:

Lineage for d1tyhe_ (1tyh E:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein Transcriptional activator TenA [110030] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110031] (4 PDB entries)
   Uniprot P25052

8. Domain d1tyhe_: 1tyh E: [107461]

Details for d1tyhe_

PDB Entry: 1tyh, 2.54 Å

PDB Description: crystal structure of transcriptional activator tena from bacillus subtilis

PDB Compounds: (E:) Transcriptional activator tenA

SCOPe Domain Sequences for d1tyhe_:

Sequence; same for both SEQRES and ATOM records:

>d1tyhe_ a.132.1.3 (E:) Transcriptional activator TenA {Bacillus subtilis [TaxId: 1423]}
lkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaa
yakdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsv
lsgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfd
elaensteevrakmkenfvissyyeyqfwgmayrkegwsds

Timeline for d1tyhe_:

• d1tyhe_ first appeared in SCOP 1.69
  
• d1tyhe_ appears in SCOP 1.75
  
• d1tyhe_ appears in SCOPe 2.02
  
• d1tyhe_ appears in the current release, SCOPe 2.08, called d1tyhe1