SCOP 1.69: Domain d1txka1: 1txk A:397-511

Lineage for d1txka1 (1txk A:397-511)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (17 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Glucans biosynthesis protein G (MdoG, OpgG), C-terminal domain [110054] (1 species)

7. Species Escherichia coli [TaxId:562] [110055] (1 PDB entry)

8. Domain d1txka1: 1txk A:397-511 [107425]
   Other proteins in same PDB: d1txka2, d1txkb2

Details for d1txka1

PDB Entry: 1txk, 2.5 Å

PDB Description: Crystal structure of Escherichia coli OpgG

SCOP Domain Sequences for d1txka1:

Sequence; same for both SEQRES and ATOM records:

>d1txka1 b.1.18.2 (A:397-511) Glucans biosynthesis protein G (MdoG, OpgG), C-terminal domain {Escherichia coli}
pdnawvqqtrrstgdvkqsnlirqpdgtiafvvdftgaemkklpedtpvtaqtsigdnge
ivestvrynpvtkgwrlvmrvkvkdakkttemraalvnadqtlsetwsyqlpane

Timeline for d1txka1:

• d1txka1 is new in SCOP 1.69
  
• d1txka1 appears in SCOP 1.71
  
• d1txka1 appears in the current release, SCOPe 2.08