Lineage for d1txka1 (1txk A:397-511)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551984Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 552070Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (18 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 552188Protein Glucans biosynthesis protein G (MdoG, OpgG), C-terminal domain [110054] (1 species)
  7. 552189Species Escherichia coli [TaxId:562] [110055] (1 PDB entry)
  8. 552190Domain d1txka1: 1txk A:397-511 [107425]
    Other proteins in same PDB: d1txka2, d1txkb2

Details for d1txka1

PDB Entry: 1txk (more details), 2.5 Å

PDB Description: Crystal structure of Escherichia coli OpgG

SCOP Domain Sequences for d1txka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txka1 b.1.18.2 (A:397-511) Glucans biosynthesis protein G (MdoG, OpgG), C-terminal domain {Escherichia coli}
pdnawvqqtrrstgdvkqsnlirqpdgtiafvvdftgaemkklpedtpvtaqtsigdnge
ivestvrynpvtkgwrlvmrvkvkdakkttemraalvnadqtlsetwsyqlpane

SCOP Domain Coordinates for d1txka1:

Click to download the PDB-style file with coordinates for d1txka1.
(The format of our PDB-style files is described here.)

Timeline for d1txka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1txka2