PDB entry 1txk

View 1txk on RCSB PDB site
Description: Crystal structure of Escherichia coli OpgG
Deposited on 2004-07-05, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1txkA (A:)
    mfsiddvakqaqslagkgyetpksnlpsvfrdmkyadyqqiqfnhdkaywnnlktpfkle
    fyhqgmyfdtpvkinevtatavkrikyspdyftfgdvqhdkdtvkdlgfagfkvlypins
    kdkndeivsmlgasyfrvigagqvyglsarglaidtalpsgeefprfkefwierpkptdk
    rltiyalldspratgaykfvvmpgrdtvvdvqskiylrdkvgklgvapltsmflfgpnqp
    spannyrpelhdsnglsihagngewiwrplnnpkhlavssfsmenpqgfgllqrgrdfsr
    fedlddrydlrpsawvtpkgewgkgsvelveiptndetndnivaywtpdqlpepgkemnf
    kytitfsrdedklhapdnawvqqtrrstgdvkqsnlirqpdgtiafvvdftgaemkklpe
    dtpvtaqtsigdngeivestvrynpvtkgwrlvmrvkvkdakkttemraalvnadqtlse
    twsyqlpanevehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txkA (A:)
    fsiddvakqaqslagkgyetpksnlpsmkyadyqqiqfnhdkaywnnlktpfklefyhqg
    myfdtpvkinevtatavkrikyspdyftfgdvqhdkdtvkdlgfagfkvlypinskdknd
    eivsmlgasyfrvigagqvyglsarglaidtalpsgeefprfkefwierpkptdkrltiy
    alldspratgaykfvvmpgrdtvvdvqskiylrdkvgklgvapltsmflfgpnqpspann
    yrpelhdsnglsihagngewiwrplnnpkhlavssfsmenpqgfgllqrgrdfsrfedld
    drydlrpsawvtpkgewgkgsvelveiptndetndnivaywtpdqlpepgkemnfkytit
    fsrdedklhapdnawvqqtrrstgdvkqsnlirqpdgtiafvvdftgaemkklpedtpvt
    aqtsigdngeivestvrynpvtkgwrlvmrvkvkdakkttemraalvnadqtlsetwsyq
    lpanevehhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1txkB (B:)
    mfsiddvakqaqslagkgyetpksnlpsvfrdmkyadyqqiqfnhdkaywnnlktpfkle
    fyhqgmyfdtpvkinevtatavkrikyspdyftfgdvqhdkdtvkdlgfagfkvlypins
    kdkndeivsmlgasyfrvigagqvyglsarglaidtalpsgeefprfkefwierpkptdk
    rltiyalldspratgaykfvvmpgrdtvvdvqskiylrdkvgklgvapltsmflfgpnqp
    spannyrpelhdsnglsihagngewiwrplnnpkhlavssfsmenpqgfgllqrgrdfsr
    fedlddrydlrpsawvtpkgewgkgsvelveiptndetndnivaywtpdqlpepgkemnf
    kytitfsrdedklhapdnawvqqtrrstgdvkqsnlirqpdgtiafvvdftgaemkklpe
    dtpvtaqtsigdngeivestvrynpvtkgwrlvmrvkvkdakkttemraalvnadqtlse
    twsyqlpanevehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1txkB (B:)
    mfsiddvakqaqslagkgyetpksnlpsmkyadyqqiqfnhdkaywnnlktpfklefyhq
    gmyfdtpvkinevtatavkrikyspdyftfgdvqhdkdtvkdlgfagfkvlypinskdkn
    deivsmlgasyfrvigagqvyglsarglaidtalpsgeefprfkefwierpkptdkrlti
    yalldspratgaykfvvmpgrdtvvdvqskiylrdkvgklgvapltsmflfgpnqpspan
    nyrpelhdsnglsihagngewiwrplnnpkhlavssfsmenpqgfgllqrgrdfsrfedl
    ddrydlrpsawvtpkgewgkgsvelveiptndetndnivaywtpdqlpepgkemnfkyti
    tfsrdedklhapdnawvqqtrrstgdvkqsnlirqpdgtiafvvdftgaemkklpedtpv
    taqtsigdngeivestvrynpvtkgwrlvmrvkvkdakkttemraalvnadqtlsetwsy
    qlpanev