Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (5 proteins) |
Protein Carminomycin 4-O-methyltransferase [110660] (1 species) |
Species Streptomyces peucetius [TaxId:1950] [110661] (2 PDB entries) Uniprot Q06528 |
Domain d1tw3b2: 1tw3 B:99-351 [107376] Other proteins in same PDB: d1tw3a1, d1tw3b1 complexed with ert, sah |
PDB Entry: 1tw3 (more details), 2.35 Å
SCOPe Domain Sequences for d1tw3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tw3b2 c.66.1.12 (B:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} paaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsl lacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtar sylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggr iliherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspt ipydlsllvlapa
Timeline for d1tw3b2: