Lineage for d1tw3b2 (1tw3 B:99-351)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1378686Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
    automatically mapped to Pfam PF00891
  6. 1378702Protein Carminomycin 4-O-methyltransferase [110660] (1 species)
  7. 1378703Species Streptomyces peucetius [TaxId:1950] [110661] (2 PDB entries)
    Uniprot Q06528
  8. 1378705Domain d1tw3b2: 1tw3 B:99-351 [107376]
    Other proteins in same PDB: d1tw3a1, d1tw3b1
    complexed with ert, sah

Details for d1tw3b2

PDB Entry: 1tw3 (more details), 2.35 Å

PDB Description: crystal structure of carminomycin-4-o-methyltransferase (dnrk) in complex with s-adenosyl-l-homocystein (sah) and 4-methoxy-e- rhodomycin t (m-et)
PDB Compounds: (B:) Carminomycin 4-O-methyltransferase

SCOPe Domain Sequences for d1tw3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tw3b2 c.66.1.12 (B:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}
paaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsl
lacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtar
sylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggr
iliherddlhensfneqfteldlrmlvflggalrtrekwdglaasaglvveevrqlpspt
ipydlsllvlapa

SCOPe Domain Coordinates for d1tw3b2:

Click to download the PDB-style file with coordinates for d1tw3b2.
(The format of our PDB-style files is described here.)

Timeline for d1tw3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tw3b1