PDB entry 1tw3

View 1tw3 on RCSB PDB site
Description: Crystal structure of Carminomycin-4-O-methyltransferase (DnrK) in complex with S-adenosyl-L-homocystein (SAH) and 4-methoxy-e-rhodomycin T (M-ET)
Class: transferase
Keywords: Anthracycline, methyltransferase, methylate, Streptomyces, tailoring enzyme, polyketide, S-adenosyl-L-homocystein
Deposited on 2004-06-30, released 2004-09-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.196
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carminomycin 4-O-methyltransferase
    Species: Streptomyces peucetius [TaxId:1950]
    Gene: dnrk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1tw3a1, d1tw3a2
  • Chain 'B':
    Compound: Carminomycin 4-O-methyltransferase
    Species: Streptomyces peucetius [TaxId:1950]
    Gene: dnrk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1tw3b1, d1tw3b2
  • Heterogens: SAH, ERT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tw3A (A:)
    gspnstaeptvaarpqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaa
    rtdtrpeallrlirhlvaiglleedapgefvptevgelladdhpaaqrawhdltqavara
    disftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsllacdqdvafdapaaayd
    wtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtarsylkdeglsdrvdvveg
    dffeplprkadaiilsfvllnwpdhdavriltrcaealepggriliherddlhensfneq
    fteldlrmlvflggalrtrekwdglaasaglvveevrqlpsptipydlsllvlapaatga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw3A (A:)
    qidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrlirhl
    vaiglleedapgefvptevgelladdhpaaqrawhdltqavaradisftrlpdairtgrp
    tyesiygkpfyedlagrpdlrasfdsllacdqdvafdapaaaydwtnvrhvldvgggkgg
    faaaiarraphvsatvlemagtvdtarsylkdeglsdrvdvvegdffeplprkadaiils
    fvllnwpdhdavriltrcaealepggriliherddlhensfneqfteldlrmlvflggal
    rtrekwdglaasaglvveevrqlpsptipydlsllvlapa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tw3B (B:)
    gspnstaeptvaarpqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaa
    rtdtrpeallrlirhlvaiglleedapgefvptevgelladdhpaaqrawhdltqavara
    disftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsllacdqdvafdapaaayd
    wtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtarsylkdeglsdrvdvveg
    dffeplprkadaiilsfvllnwpdhdavriltrcaealepggriliherddlhensfneq
    fteldlrmlvflggalrtrekwdglaasaglvveevrqlpsptipydlsllvlapaatga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw3B (B:)
    qidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrlirhl
    vaiglleedapgefvptevgelladdhpaaqrawhdltqavaradisftrlpdairtgrp
    tyesiygkpfyedlagrpdlrasfdsllacdqdvafdapaaaydwtnvrhvldvgggkgg
    faaaiarraphvsatvlemagtvdtarsylkdeglsdrvdvvegdffeplprkadaiils
    fvllnwpdhdavriltrcaealepggriliherddlhensfneqfteldlrmlvflggal
    rtrekwdglaasaglvveevrqlpsptipydlsllvlapa