Lineage for d1tvka2 (1tvk A:246-439)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959167Protein Tubulin alpha-subunit [55311] (3 species)
  7. 2959168Species Cow (Bos taurus) [TaxId:9913] [64321] (5 PDB entries)
    Uniprot P02550
  8. 2959169Domain d1tvka2: 1tvk A:246-439 [107363]
    Other proteins in same PDB: d1tvka1, d1tvkb1, d1tvkb2
    complexed with ep, gdp, gtp

Details for d1tvka2

PDB Entry: 1tvk (more details), 2.89 Å

PDB Description: the binding mode of epothilone a on a,b-tubulin by electron crystallography
PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d1tvka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvka2 d.79.2.1 (A:246-439) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprghfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOPe Domain Coordinates for d1tvka2:

Click to download the PDB-style file with coordinates for d1tvka2.
(The format of our PDB-style files is described here.)

Timeline for d1tvka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tvka1