Lineage for d1tvkb2 (1tvk B:246-427)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525500Protein Tubulin beta-subunit [55313] (2 species)
  7. 2525501Species Cow (Bos taurus) [TaxId:9913] [64322] (6 PDB entries)
    Uniprot P02554
  8. 2525511Domain d1tvkb2: 1tvk B:246-427 [107365]
    Other proteins in same PDB: d1tvka1, d1tvka2, d1tvkb1
    complexed with ep, gdp, gtp

Details for d1tvkb2

PDB Entry: 1tvk (more details), 2.89 Å

PDB Description: the binding mode of epothilone a on a,b-tubulin by electron crystallography
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d1tvkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvkb2 d.79.2.1 (B:246-427) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
lnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaacdp
rhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsa
tfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqy
qd

SCOPe Domain Coordinates for d1tvkb2:

Click to download the PDB-style file with coordinates for d1tvkb2.
(The format of our PDB-style files is described here.)

Timeline for d1tvkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tvkb1