![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins) |
![]() | Protein Tubulin alpha-subunit [55311] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [64321] (4 PDB entries) |
![]() | Domain d1tvka2: 1tvk A:246-439 [107363] Other proteins in same PDB: d1tvka1, d1tvkb1, d1tvkb2 |
PDB Entry: 1tvk (more details), 2.89 Å
SCOP Domain Sequences for d1tvka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tvka2 d.79.2.1 (A:246-439) Tubulin alpha-subunit {Cow (Bos taurus)} galnvdltefqtnlvpyprghfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvds
Timeline for d1tvka2: