Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.8: Polyketide synthesis cyclase [110959] (1 protein) Pfam PF04673 |
Protein Tetracenomycin polyketide synthesis protein TcmI [110960] (1 species) |
Species Streptomyces glaucescens [TaxId:1907] [110961] (1 PDB entry) |
Domain d1tuwa_: 1tuw A: [107346] complexed with so4 |
PDB Entry: 1tuw (more details), 1.9 Å
SCOP Domain Sequences for d1tuwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tuwa_ d.58.4.8 (A:) Tetracenomycin polyketide synthesis protein TcmI {Streptomyces glaucescens [TaxId: 1907]} ayralmvlrmdpadaehvaaafaehdttelpleigvrrrvlfrfhdlymhlieadddime rlyqarshplfqevnervgqyltpyaqdweelkdskaevfyswtap
Timeline for d1tuwa_: