Lineage for d1tuwa_ (1tuw A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603552Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 603646Family d.58.4.8: Polyketide synthesis cyclase [110959] (1 protein)
    Pfam 04673
  6. 603647Protein Tetracenomycin polyketide synthesis protein TcmI [110960] (1 species)
  7. 603648Species Streptomyces glaucescens [TaxId:1907] [110961] (1 PDB entry)
  8. 603649Domain d1tuwa_: 1tuw A: [107346]
    complexed with so4

Details for d1tuwa_

PDB Entry: 1tuw (more details), 1.9 Å

PDB Description: structural and functional analysis of tetracenomycin f2 cyclase from streptomyces glaucescens: a type-ii polyketide cyclase

SCOP Domain Sequences for d1tuwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuwa_ d.58.4.8 (A:) Tetracenomycin polyketide synthesis protein TcmI {Streptomyces glaucescens}
ayralmvlrmdpadaehvaaafaehdttelpleigvrrrvlfrfhdlymhlieadddime
rlyqarshplfqevnervgqyltpyaqdweelkdskaevfyswtap

SCOP Domain Coordinates for d1tuwa_:

Click to download the PDB-style file with coordinates for d1tuwa_.
(The format of our PDB-style files is described here.)

Timeline for d1tuwa_: