Lineage for d1tuwa_ (1tuw A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949870Family d.58.4.8: Polyketide synthesis cyclase [110959] (1 protein)
    Pfam PF04673
  6. 2949871Protein Tetracenomycin polyketide synthesis protein TcmI [110960] (1 species)
  7. 2949872Species Streptomyces glaucescens [TaxId:1907] [110961] (1 PDB entry)
    Uniprot P39890
  8. 2949873Domain d1tuwa_: 1tuw A: [107346]
    complexed with so4

Details for d1tuwa_

PDB Entry: 1tuw (more details), 1.9 Å

PDB Description: structural and functional analysis of tetracenomycin f2 cyclase from streptomyces glaucescens: a type-ii polyketide cyclase
PDB Compounds: (A:) Tetracenomycin polyketide synthesis protein tcmI

SCOPe Domain Sequences for d1tuwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuwa_ d.58.4.8 (A:) Tetracenomycin polyketide synthesis protein TcmI {Streptomyces glaucescens [TaxId: 1907]}
ayralmvlrmdpadaehvaaafaehdttelpleigvrrrvlfrfhdlymhlieadddime
rlyqarshplfqevnervgqyltpyaqdweelkdskaevfyswtap

SCOPe Domain Coordinates for d1tuwa_:

Click to download the PDB-style file with coordinates for d1tuwa_.
(The format of our PDB-style files is described here.)

Timeline for d1tuwa_: