SCOPe 2.08: Domain d1tqye2: 1tqy E:258-423

Lineage for d1tqye2 (1tqy E:258-423)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA, C-terminal domain [419011] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [419483] (1 PDB entry)
   Uniprot Q02059

8. Domain d1tqye2: 1tqy E:258-423 [107254]
   Other proteins in same PDB: d1tqya1, d1tqyb1, d1tqyb2, d1tqyc1, d1tqyd1, d1tqyd2, d1tqye1, d1tqyf1, d1tqyf2, d1tqyg1, d1tqyh1, d1tqyh2
   complexed with ace, mg, na

Details for d1tqye2

PDB Entry: 1tqy, 2 Å

PDB Description: the actinorhodin ketosynthase/chain length factor

PDB Compounds: (E:) Actinorhodin polyketide putative beta-ketoacyl synthase 1

SCOPe Domain Sequences for d1tqye2:

Sequence; same for both SEQRES and ATOM records:

>d1tqye2 c.95.1.1 (E:258-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA, C-terminal domain {Streptomyces coelicolor [TaxId: 1902]}
rihaeisgyatrcnayhmtglkadgremaetirvaldesrtdatdidyinahgsgtrqnd
rhetaaykralgeharrtpvssiksmvghslgaigsleiaacvlalehgvvpptanlrts
dpecdldyvplearerklrsvltvgsgfggfqsamvlrdaetagaa

Timeline for d1tqye2:

• d1tqye2 first appeared in SCOP 1.69
  
• d1tqye2 appears in SCOPe 2.07