| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
| Protein Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA, C-terminal domain [419011] (1 species) |
| Species Streptomyces coelicolor [TaxId:1902] [419483] (1 PDB entry) Uniprot Q02059 |
| Domain d1tqye2: 1tqy E:258-423 [107254] Other proteins in same PDB: d1tqya1, d1tqyb1, d1tqyb2, d1tqyc1, d1tqyd1, d1tqyd2, d1tqye1, d1tqyf1, d1tqyf2, d1tqyg1, d1tqyh1, d1tqyh2 complexed with ace, mg, na |
PDB Entry: 1tqy (more details), 2 Å
SCOPe Domain Sequences for d1tqye2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqye2 c.95.1.1 (E:258-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA, C-terminal domain {Streptomyces coelicolor [TaxId: 1902]}
rihaeisgyatrcnayhmtglkadgremaetirvaldesrtdatdidyinahgsgtrqnd
rhetaaykralgeharrtpvssiksmvghslgaigsleiaacvlalehgvvpptanlrts
dpecdldyvplearerklrsvltvgsgfggfqsamvlrdaetagaa
Timeline for d1tqye2: